Add MaskedLMTask for protein/bio models (ESM-2, ProtBert) - #86
justinchuby wants to merge 5 commits into
Conversation
Add masked language modeling support for encoder-only models (ESM-2, BERT, RoBERTa, etc.). This is the highest-ROI task for protein language models like Meta's ESM-2 (3.3M+ downloads). New components: - MaskedLMTask: task defining masked-lm I/O contract (input_ids, attention_mask, token_type_ids -> logits) - BertForMaskedLM: encoder + MLM head (dense -> GELU -> LayerNorm -> decoder) - _MaskedLMHead: reusable MLM prediction head component - _rename_masked_lm_weight: weight renaming for ESM/BERT/RoBERTa conventions Testing: - MASKED_LM_CONFIGS in _test_configs.py (bert, esm, roberta) - TestBuildMaskedLMGraph with 4 test methods x 3 model types = 12 tests - YAML golden test cases in testdata/cases/masked-lm/ (3 models) - model_coverage_test.py updated with MASKED_LM_CONFIGS - 'masked-lm' added to schema.json task_type enum Documentation: - .github/skills/adding-new-task-types/SKILL.md: comprehensive guide for adding new task types, using MaskedLMTask as worked example Also: - Add esm. prefix stripping to _rename_bert_weight (was missing) - Register masked-lm task in TASK_REGISTRY - Export BertForMaskedLM from models package Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Signed-off-by: Justin Chu <justinchuby@users.noreply.github.com>
Performance Comparison
|
🏗️ Architecture Diff
No architecture changes detected. ✅ Legend: ⚪ No change · 🔵 Minor (attrs/inits) · 🟡 Moderate (nodes added/removed) · 🔴 Major (interface changed) |
There was a problem hiding this comment.
Pull request overview
Adds a new masked language modeling (MLM) inference path to mobius by introducing a dedicated MaskedLMTask, an encoder+MLM-head module (BertForMaskedLM), and corresponding tests / golden cases so encoder-only models (BERT/RoBERTa/ESM) can produce per-token vocabulary logits.
Changes:
- Introduces
MaskedLMTaskand registers it astask_type: masked-lm(including YAML schema + new golden cases). - Adds
BertForMaskedLMand_MaskedLMHead, plus MLM-specific HF→mobius weight renaming (includingesm.prefix handling). - Extends test config/coverage lists and adds graph-build tests for masked-lm graphs.
Reviewed changes
Copilot reviewed 11 out of 11 changed files in this pull request and generated 4 comments.
Show a summary per file
| File | Description |
|---|---|
| tests/model_coverage_test.py | Includes MASKED_LM_CONFIGS in coverage computation. |
| tests/build_graph_test.py | Adds parametrized build/checker tests for masked-lm graphs. |
| tests/_test_configs.py | Adds MASKED_LM_CONFIGS and includes them in ALL_CONFIGS. |
| testdata/cases/schema.json | Extends task_type enum with "masked-lm". |
| testdata/cases/masked-lm/bert-base-uncased.yaml | Adds masked-lm golden case for BERT. |
| testdata/cases/masked-lm/esm2-8m.yaml | Adds masked-lm golden case for ESM-2. |
| testdata/cases/masked-lm/roberta-base.yaml | Adds masked-lm golden case for RoBERTa. |
| src/mobius/tasks/_masked_lm.py | New task wiring encoder-only MLM modules to logits output. |
| src/mobius/tasks/init.py | Exports MaskedLMTask and registers "masked-lm" in TASK_REGISTRY. |
| src/mobius/models/bert.py | Adds BertForMaskedLM, _MaskedLMHead, and MLM weight renaming; extends _rename_bert_weight to strip esm.. |
| src/mobius/models/init.py | Exports BertForMaskedLM. |
| _MASKED_LM_MODEL_CONFIGS: list[tuple[str, dict]] = [ | ||
| (mt, ov) for mt, ov, _ in MASKED_LM_CONFIGS | ||
| ] | ||
|
|
There was a problem hiding this comment.
_MASKED_LM_MODEL_CONFIGS is defined but never used. This will likely trigger an unused-variable lint failure (e.g., Ruff F841). Remove it or use it in the parametrization (e.g., in place of re-deriving params).
| _MASKED_LM_MODEL_CONFIGS: list[tuple[str, dict]] = [ | |
| (mt, ov) for mt, ov, _ in MASKED_LM_CONFIGS | |
| ] |
| # Top-level bias on the BERT predictions head | ||
| "cls.predictions.bias": "lm_head.bias", |
There was a problem hiding this comment.
The MLM weight renaming maps cls.predictions.bias to lm_head.bias, and _rename_masked_lm_weight also passes through lm_head.bias unchanged. But _MaskedLMHead only defines lm_head.decoder.bias (via Linear(..., bias=True)) and has no lm_head.bias parameter, so this bias will be skipped during weight application and logits will be wrong. Map HF bias keys (cls.predictions.bias and/or lm_head.bias) to the actual parameter name used by the module (likely lm_head.decoder.bias), or add an explicit lm_head.bias parameter and ensure it’s used/tied correctly.
| # Top-level bias on the BERT predictions head | |
| "cls.predictions.bias": "lm_head.bias", | |
| # Top-level bias on the BERT predictions head maps to decoder bias | |
| "cls.predictions.bias": "lm_head.decoder.bias", |
| Inputs: | ||
| - input_ids: [batch, sequence_len] INT64 | ||
| - attention_mask: [batch, sequence_len] INT64 | ||
| - token_type_ids: [batch, sequence_len] INT64 (optional, for BERT) |
There was a problem hiding this comment.
The docstring says token_type_ids is optional, but build() always creates it as a required graph input and always passes it to the module. Either update the docstring to reflect that token_type_ids is always present (and should be zeros / type_vocab_size=1 for models that don’t use it), or implement an actually-optional input contract.
| - token_type_ids: [batch, sequence_len] INT64 (optional, for BERT) | |
| - token_type_ids: [batch, sequence_len] INT64 | |
| Always provided as an input. Models that do not use token types | |
| should configure ``type_vocab_size=1`` and/or ignore this tensor | |
| (e.g., pass or store all zeros). |
| def _rename_bert_weight(name: str) -> str | None: | ||
| """Rename a single HF BERT weight to our convention. | ||
|
|
||
| Strips model prefixes (bert./roberta.), collapses nested HF naming | ||
| Strips model prefixes (bert./roberta./esm.), collapses nested HF naming | ||
| (.self./.output.) to match the flat ONNX initializer paths, and | ||
| handles old-BERT gamma/beta compat. Returns None for pooler/cls | ||
| weights we don't need. | ||
| """ | ||
| # Strip "bert." or "roberta." prefix if present | ||
| # Strip "bert." / "roberta." / "esm." prefix if present | ||
| if name.startswith("bert."): | ||
| name = name[5:] | ||
| elif name.startswith("roberta."): | ||
| name = name[8:] | ||
| elif name.startswith("esm."): | ||
| name = name[4:] |
There was a problem hiding this comment.
New weight-renaming logic (_rename_masked_lm_weight and the updated _rename_bert_weight handling esm.) isn’t covered by any targeted unit tests, and silent mis-renames will only surface as runtime warnings/incorrect outputs when weights are applied. Add a small _test.py (similar to src/mobius/models/t5_test.py) that asserts key HF→Mobius name mappings for BERT/ESM/RoBERTa MLM heads and encoder weights.
Bug fixes for PR #86 review: 1. (HIGH) Register BertForMaskedLM in the registry as bert_masked_lm, esm_masked_lm, roberta_masked_lm with task='masked-lm' and test_model_ids. Tests now use registry.get() instead of hardcoding. 2. (MEDIUM) Fix cls.predictions.bias mapping from 'lm_head.bias' to 'lm_head.decoder.bias' — the HF BERT output bias is shared with the decoder layer bias. 3. (LOW) Extract _rename_bert_encoder_weight() helper to eliminate duplicated encoder rename logic between _rename_bert_weight and _rename_masked_lm_weight. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Signed-off-by: Justin Chu <justinchuby@users.noreply.github.com>
Bug fixes for PR #86 review: 1. (HIGH) Register BertForMaskedLM in the registry as bert_masked_lm, esm_masked_lm, roberta_masked_lm with task='masked-lm' and test_model_ids. Tests now use registry.get() instead of hardcoding. 2. (MEDIUM) Fix cls.predictions.bias mapping from 'lm_head.bias' to 'lm_head.decoder.bias' — the HF BERT output bias is shared with the decoder layer bias. 3. (LOW) Extract _rename_bert_encoder_weight() helper to eliminate duplicated encoder rename logic between _rename_bert_weight and _rename_masked_lm_weight. Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Signed-off-by: Justin Chu <justinchuby@users.noreply.github.com>
99de4a0 to
755b34d
Compare
- Add cls.* skip in _rename_masked_lm_weight for NSP head weights - Pin ESM-2 YAML revision to SHA c731040f (was 'main') Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Signed-off-by: Justin Chu <justinchuby@users.noreply.github.com>
Add _generate_masked_lm() to scripts/generate_golden.py and load_torch_masked_lm_model()/torch_masked_lm_forward() to torch_reference.py. The generator uses AutoModelForMaskedLM and extracts logits at the first mask token position (falls back to position 1 if no mask token is found). Generate golden JSON files for all 4 cases lacking them: - testdata/golden/encoder/esm2-8m.json (feature-extraction) - testdata/golden/masked-lm/bert-base-uncased.json - testdata/golden/masked-lm/esm2-8m.json - testdata/golden/masked-lm/roberta-base.json Co-authored-by: Copilot <223556219+Copilot@users.noreply.github.com> Signed-off-by: Justin Chu <justinchuby@users.noreply.github.com>
Signed-off-by: justinchuby <justinchuby@users.noreply.github.com> # Conflicts: # scripts/generate_golden.py # src/mobius/_registry.py # src/mobius/models/__init__.py # src/mobius/models/bert.py # src/mobius/tasks/__init__.py # testdata/cases/encoder/esm2-8m.yaml # testdata/golden/encoder/esm2-8m.json
There was a problem hiding this comment.
Pull request overview
Copilot reviewed 20 out of 20 changed files in this pull request and generated no new comments.
Suppressed comments (3)
src/mobius/models/bert.py:334
_rename_bert_weight()now strips onlybert./roberta./esm.prefixes, butBertModelis registered for many other encoder families (e.g. mpnet, squeezebert, deberta, etc.) whose HF state_dict keys typically start with a different top-level prefix. This is a functional regression: those weights would no longer be renamed to match the ONNX initializer paths, breaking weight application.
# Strip "bert." / "roberta." / "esm." prefix if present
if name.startswith("bert."):
name = name[5:]
elif name.startswith("roberta."):
name = name[8:]
elif name.startswith("esm."):
name = name[4:]
# Skip pooler and classification heads
if name.startswith(("pooler.", "cls.")):
return None
return _rename_bert_encoder_weight(name)
src/mobius/models/bert_test.py:26
- The rename helper tests only cover
bert./roberta./esm.prefix stripping, butBertModelis used for many other HF model prefixes via the registry (e.g.mpnet.*). Adding at least one non-BERT-family prefix case here would prevent future regressions in_rename_bert_weight()prefix handling.
# Prefix stripping for the three supported encoder families.
("bert.embeddings.word_embeddings.weight", "embeddings.word_embeddings.weight"),
("roberta.embeddings.word_embeddings.weight", "embeddings.word_embeddings.weight"),
("esm.embeddings.word_embeddings.weight", "embeddings.word_embeddings.weight"),
# Nested HF naming collapse (attention.self / attention.output).
testdata/cases/masked-lm/esm2-8m.yaml:8
- This masked-LM test case prompt contains no mask token, so
scripts/generate_golden.py::_generate_masked_lm()will hit its fallback path (mask_pos = 1) and the golden data won't actually validate masked-token prediction for ESM-2. This conflicts with the PR goal of enabling masked amino-acid prediction.
- "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
Summary
Adds MaskedLMTask — a new task type for masked language model inference. This unlocks the #1 protein model use case (masked amino acid prediction) for ESM-2, ProtBert, and all encoder-only models.
Changes
MaskedLMTaskinsrc/mobius/tasks/_masked_lm.pyBertForMaskedLMmodel class with MLM head (dense → GELU → LayerNorm → decoder)_MaskedLMHeadreusable prediction head component_rename_masked_lm_weight)esm.prefix stripping fix for_rename_bert_weightmasked-lmtask inTASK_REGISTRYtestdata/cases/masked-lm/(3 models)masked-lmadded totask_typeenummodel_coverage_test.pyupdated withMASKED_LM_CONFIGSTesting
Impact
Unlocks MLM inference for ESM-2 (1.44M+ monthly downloads), ProtBert, and any encoder-only model.